PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_004921
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family YABBY
Protein Properties Length: 230aa    MW: 25239.6 Da    PI: 7.8734
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_004921genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY231.22.5e-71211885170
        YABBY   5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaes.hlde.slkeelleelkveeenlksn.vekeesastsvsse 99 
                  +sse++Cyv+Cn C+t+lavsvP +slfk+vtvrCGhCt+ll vn++      + +  hl++ sl ++ ++ l  e  n + n ++++ +  ++ s  
  DCAR_004921  21 QSSEKLCYVHCNICDTVLAVSVPCSSLFKTVTVRCGHCTNLLPVNMRALLLPSPNQPhHLGHhSLFPPSHHSLMEEIPNSSPNyMINQANMINDFSL- 117
                  589****************************************888777766665541455414455566665555555554404444444444444. PP

        YABBY 100 klsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                  +      +e+pr+p ++rPPekrqrvPsaynrfik+eiqrika+nPdishreafsaaaknWahfP+ihfgl
  DCAR_004921 118 SSRAGGFDEIPRPPAINRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 188
                  43677889*************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046908.5E-7122188IPR006780YABBY protein
SuperFamilySSF470959.43E-8133181IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.102.3E-4137180IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MSSSSSSNSS LLSPNEHLPP QSSEKLCYVH CNICDTVLAV SVPCSSLFKT VTVRCGHCTN  60
LLPVNMRALL LPSPNQPHHL GHHSLFPPSH HSLMEEIPNS SPNYMINQAN MINDFSLSSR  120
AGGFDEIPRP PAINRPPEKR QRVPSAYNRF IKDEIQRIKA GNPDISHREA FSAAAKNWAH  180
FPHIHFGLMP ADQTTAKKTT TTVCQQDSAE DILMKDGFFA SANIGVSPY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266233.11e-115PREDICTED: protein YABBY 4
SwissprotO221522e-79YAB1_ARATH; Axial regulator YABBY 1
TrEMBLD7TN101e-115D7TN10_VITVI; Putative uncharacterized protein
STRINGVIT_02s0154g00070.t011e-114(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38124163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.11e-73YABBY family protein